Domain assignment for gi|238918695|ref|YP_002932209.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 137 Pili subunits 7.85e-22 Pilin 0.0017 1oqw A: Alignments

Protein Sequence Details

Sequence length 150
Comment prepilin-type N-terminal cleavage/methylation domain protein [Edwardsiella ictaluri 93-146]
Sequence
MSSQHGFTLLELMIVIAIIAILGAIAVPAYQRYLQKAAMTDVLQAVTPYRTEVELCALEQGNLAPCSEAQLGLAAFPPSAYVSTLSVDAGIISLSGQQTLAGLRVTLTPTLDRSAGTLRWQQRCQSEDNNTALLEACRSVLRETDGGERP

Download

Sequence (FASTA)