Domain assignment for gi|238918680|ref|YP_002932194.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
93 296 Glutathione synthetase ATP-binding domain-like 2.65e-51 ATP-binding domain of peptide synthetases 0.000000858 1iow A:97-306 Alignments
3 92 PreATP-grasp domain 1.63e-21 D-Alanine ligase N-terminal domain 0.000053 1iow A:1-96 Alignments

Protein Sequence Details

Sequence length 300
Comment D-alanine-D-alanine ligase B, putative [Edwardsiella ictaluri 93-146]
Sequence
MAEKVAVLLGGTSAERDVSLLSGQAVLNGLKQAGIDAYPADTRRFPATQLREAGFERVFIALYGRGSLQGVLEFLQLPYTGSDVMASALTMDKLRSKQVWQAAGLPVVPYVAISREQFDEGLTMDTLHEINDLGLPLIVKPSREGSSVGMSKVSEPCEFDPALVEALRHDDEILIEKWLSGPEYTVAFIGDEIFPSIRIQMADAFYDYEVKYLSDKAEYFCPSGLSDEQEQALVALVRRAYKALGCSGWGRVDVIQDTSGEFCLLEANTAPGSHSLTPMAACQAGMSFSPLVVRILELAD

Download

Sequence (FASTA)