Domain assignment for gi|238918678|ref|YP_002932192.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 345 UDP-Glycosyltransferase/glycogen phosphorylase 2.09e-125 Peptidoglycan biosynthesis glycosyltransferase MurG 0.000000000151 1f0k A: Alignments

Protein Sequence Details

Sequence length 346
Comment undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MVMAGGTGGHVFPGLAVAHYLQAQGWQIHWLGTADRMEAQLVPQHGIEIDFIQISGLRGKGIKVLLGAPFRIVRAVLQARRIIKAYRPDAVLGMGGYVSGPGGLAAWMCGVPVVLHEQNGIAGLTNRWLSKIAKRVLQAFPGAFPHAPVVGNPVREDVLALPAPAQRMAGRTGPVRVLVVGGSQGARILNQTLPAVAARLGEQVTLWHQTGKGAQPSVEAEYQRLGLQDHQVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFMHKDRQQYWNAAALARTGAARIIEQPDFSVDAVVETLAGWDRPTLLLMAEKARAAAITDATQRVAEAICNVAR

Download

Sequence (FASTA)