Domain assignment for gi|238918649|ref|YP_002932163.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
26 326 Periplasmic binding protein-like II 1.85e-64 Phosphate binding protein-like 0.0023 1y4t A: Alignments

Protein Sequence Details

Sequence length 331
Comment thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine pyrophospate-binding protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MLKKLFSILALLTVSLLAQAAGKPVLTVYTYDSFAADWGPGPKIKQAFEQSCHCELRLVPLEDGVAILNRLRMEGKNSPADLVLGLDNNLLTAARHSGLFSPSQIDTRGQQIPGGWHDATFVPYDYGYFAFVYDRQQVKNPPSSLKQLVEGPEKWRVIYQDPRTSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTSPAYHIIEEHNDRYATAMFDEGHYLQVEVAGILKHSRQPALAHQFMQFITTPAFQNAIPTGNWMYPATAVPLPPAFAALPRPQKTLSFTADDVAQHRAEWIRAWQSALSR

Download

Sequence (FASTA)