Domain assignment for gi|238918647|ref|YP_002932161.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 219 P-loop containing nucleoside triphosphate hydrolases 8.84e-64 ABC transporter ATPase domain-like 0.0000535 1q12 A:4-235 Alignments

Protein Sequence Details

Sequence length 237
Comment thiamine ABC transporter, ATP-binding protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MIRLDNLNYRYQRQTLSFSLHAAVGERIAILGPSGAGKSTLLSLIAGFLAPSSGNLYLNGIDCHRAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLNPALRLNADQRRQLEEIAGQVGILDYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPALRAEMLTLLDDICRQRQLTLLMVSHNLDDAACIAPRTLVIDDGCVAYDGPTVALLAGSVAAARLLGREVLGLTE

Download

Sequence (FASTA)