Domain assignment for gi|238918643|ref|YP_002932157.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
132 269 Chaperone J-domain 2.3e-29 Chaperone J-domain 0.0019 1hdj A: Alignments

Protein Sequence Details

Sequence length 273
Comment DnaJ domain protein [Edwardsiella ictaluri 93-146]
Sequence
MRYWGKFVGVLLGLMSGIGFWGVVLGFLIGHMFDKSRAIKRQGYFANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFREGKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELGFSHAQFDQFLGMMEGGRQFGGGYHQAGGQQGGFYTPPQGPTLEDACKVLGVASSADATTIKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK

Download

Sequence (FASTA)