Domain assignment for gi|238918638|ref|YP_002932152.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 125 ApaG-like 1.2e-46 ApaG-like 0.0000232 1xvs A: Alignments

Protein Sequence Details

Sequence length 125
Comment Protein of unknown function (DUF525) [Edwardsiella ictaluri 93-146]
Sequence
MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQLLRRYWLITNGNGRQTEVQGEGVIGEQPLIQPNGEFQYTSGAIIETPCGTMEGHYEMVDHQGHTFRIAIPVFRLAIPSLIN

Download

Sequence (FASTA)