Domain assignment for gi|238918626|ref|YP_002932140.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
23 178 PEBP-like 7.98e-51 Prokaryotic PEBP-like proteins 0.0000081 1fux A: Alignments

Protein Sequence Details

Sequence length 184
Comment conserved hypothetical protein TIGR00481 [Edwardsiella ictaluri 93-146]
Sequence
MFTKKALACLLVAGGLSLSAQAMTLSSPSVDNGKSLQNVQIFNGWGCTGQNKSPALTWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGEKESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYAGYFILQHKIGEARLTAPTNMR

Download

Sequence (FASTA)