Domain assignment for gi|238918615|ref|YP_002932129.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
187 382 Actin-like ATPase domain 3.55e-68 Actin/HSP70 0.000000015 1dkg D:186-383 Alignments
4 183 Actin-like ATPase domain 2.16e-66 Actin/HSP70 0.0000000496 1dkg D:3-185 Alignments
384 540 Heat shock protein 70kD (HSP70), peptide-binding domain 1.31e-61 Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000683 1dkz A:389-506 Alignments

Protein Sequence Details

Sequence length 635
Comment chaperone protein DnaK, putative [Edwardsiella ictaluri 93-146]
Sequence
MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQDGEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYKIVAADNGDAWVEVKDQKIAPPQISAEVLKKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEELVARSMEPLKVALKDAGLSVSDIDDVILVGGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSLGIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVRDAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEEAVKALEAASKGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK

Download

Sequence (FASTA)