Domain assignment for gi|238918585|ref|YP_002932099.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
120 252 Pentapeptide repeat-like 1.12e-33 Pentapeptide repeats 0.00025 2j8k A:1-175 Alignments
244 397 Pentapeptide repeat-like 1.57e-30 Pentapeptide repeats 0.0011 2j8k A:1-175 Alignments

Protein Sequence Details

Sequence length 438
Comment Pentapeptide repeat family protein [Edwardsiella ictaluri 93-146]
Sequence
MLPLPHSGLFSRNLSRNDISLVKNATDIGHIGSRFNRIVNKVLDWCCNTKKTEAMEQLFIVMNQDHNQSNKARCEAFDQLQELVGSAHSDRFTKKYDVVDNCIKFNIDIDGEENFITLTKDDFFEGLNLSGADLTDISLQNGKLGYVDLSGAKLDHANLTGAQLSFANLSGATLDHADLTGAQLSFAKLSGASLNNATLNQADMDNADLSNATLNQAVLKNVNLSSAILRQAKLNDADLTGADLSEAIMIEVEAVRMCAKGANLSQTDLEGAKLSKATLAGATMDETNLEAADMTSADLSRAALTNVNLNRTKLNEANLSGATLQSIVVDNIGSGVDLSGAKLTYASINDSTFHKSDFTDADLTGSGIPQCQFRDCELSHCNMTGAELSNVDFIHKEISSVGEKEFASDVYGMRLDSVKCYKVYHYNSDNKPTIINGY

Download

Sequence (FASTA)