Domain assignment for gi|238918573|ref|YP_002932087.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
122 291 Probable bacterial effector-binding domain 8.37e-43 Rob transcription factor, C-terminal domain 0.00000793 1d5y A:122-294 Alignments
57 109 Homeodomain-like 0.00000000000851 AraC type transcriptional activator 0.00021 1d5y A:57-121 Alignments
5 55 Homeodomain-like 0.000000000031 AraC type transcriptional activator 0.00029 1d5y A:3-56 Alignments

Protein Sequence Details

Sequence length 296
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MDQADIIHDLLNWLEGHLDHPLTLDNVAAKAGYSKWHLQRMFKDVTGQAIGAYIRARRLSNAAAALRLTSRPILDIALQYRFDSQQTFTRAFKKQFNKTPALYRRAEEWHAYGIRPPIRLGDYTIPTPEFITLPSLSLVGVTQSYTCTLEQICRVRTELRTQFWRDFLHTVQDIRDIPPVLYGLHHSHPNPDKDDEQSIMYTTALEPHLLPRQLTREVQSIELAGGEYAKFSYQGPTGHFQEFIMSLYNSALPALNLTRRRGHDVERFYPLEDSTQRPPKNLSCEYLIPIRHMPSP

Download

Sequence (FASTA)