Domain assignment for gi|238918538|ref|YP_002932052.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 84 PDZ domain-like 0.0000000000000171 HtrA-like serine proteases 0.0015 1ky9 A:260-353 Alignments
116 175 PDZ domain-like 0.000000128 HtrA-like serine proteases 0.0051 1ky9 B:359-446 Alignments

Protein Sequence Details

Sequence length 179
Comment protease DegQ, putative [Edwardsiella ictaluri 93-146]
Sequence
MTADLANAFKLDSPSGTFVNEILPKSVAARAGIRAGNELIPLNDTPIGSFAELRAKEGSVAPDTALQIGLLRNGKPMNVTVILENHALASVQGKTLTPTLARTSLSPGAIQKTSGICSDTLENRSPAAQIGLHKADLVIGVNHLHTRNIAALRSALVGDPPVIALHLIRGGEGMYLLRR

Download

Sequence (FASTA)