Domain assignment for gi|238918537|ref|YP_002932051.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
44 252 Trypsin-like serine proteases 3.38e-58 Prokaryotic proteases 0.000000053 1sot A:42-254 Alignments
238 344 PDZ domain-like 9.86e-21 HtrA-like serine proteases 0.00043 1sot A:255-353 Alignments

Protein Sequence Details

Sequence length 353
Comment periplasmic serine peptidase DegS, putative [Edwardsiella ictaluri 93-146]
Sequence
MLVKLLRSTLLGLAVAIVLMIALPSLRPQGLMPLFSEATFEEQPVSYNAAVRRAAPTVVNVYNGSMSGSSSGLAIKTLGSGVIMDEKGYILTNKHVVSAADQIVVALQDGRWFEAMLVGSDTLTDLAVLKIQASNLPVITINPKRVPHIGDVVLAIGNPYNIGQTTTQGIISATGRVGLSTYGHQNFLQTDASINHGNSGGALVNSLGELVGINTLSLDKSNDGETPEGIGFAIPTALATKIMNKLIRDGRVIRGFIGISGREIVPVRNQPASAERIQGIIVNSVAANGPAALAGIRPGDIVLNVNGKPAISATETMDQVAEIRPGSEVPVIIMRNGERLKLNVAIAEFPNVD

Download

Sequence (FASTA)