Domain assignment for gi|238918524|ref|YP_002932038.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 236 P-loop containing nucleoside triphosphate hydrolases 5.09e-67 ABC transporter ATPase domain-like 0.0000509 1ji0 A: Alignments

Protein Sequence Details

Sequence length 241
Comment ABC transporter, ATP-binding protein [Edwardsiella ictaluri 93-146]
Sequence
MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLEIRDDLNAEQRADRADELLDEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPDEILADEQVKRVYLGEEFRL

Download

Sequence (FASTA)