Domain assignment for gi|238918517|ref|YP_002932031.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 160 Transmembrane di-heme cytochromes 4.32e-18 Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.028 1q90 B: Alignments

Protein Sequence Details

Sequence length 163
Comment Nickel-dependent hydrogenases b-type cytochrome subunit [Edwardsiella ictaluri 93-146]
Sequence
MRLTHWSVALGFLCNRLYLTVPGGTPHQLIGLTVAGLVLLRLLWGVTWARGAARLSAFIPTPSALIHHLHELRTRTVPPVLHHNPLGALGIWATWLLLLLIALTGWGQGTDLVFRWPVDVWHVWLVDALTLVVCVHIVAVFTLSFWLRRNLINAMLPGRHGGE

Download

Sequence (FASTA)