Domain assignment for gi|238918516|ref|YP_002932030.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
23 128 Cytochromes 4.24e-31 Cytochrome b562 0.00028 256b A: Alignments

Protein Sequence Details

Sequence length 128
Comment soluble cytochrome b562, putative [Edwardsiella ictaluri 93-146]
Sequence
MRKSVLALAGLAMMAGSALAQAASVSEDMGIINQSYRQAQQATTAQDFKQALTAMRAAAAAAKSETPSKLQGQASDSADMQGYRHGLDLLIGQIDKAENLADAGHLDQAKAEAQQMLQTRNTYHKKYR

Download

Sequence (FASTA)