Domain assignment for gi|238918501|ref|YP_002932015.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
154 316 S-adenosyl-L-methionine-dependent methyltransferases 7.76e-26 Hypothetical protein MJ0882 0.0067 1dus A: Alignments

Protein Sequence Details

Sequence length 346
Comment methyltransferase, small subunit domain protein [Edwardsiella ictaluri 93-146]
Sequence
MSAFTPASEVVLRHREEFEPRRVLFAGDLQDTLPAQFNAVEVRAHTTQYHHWQALHTAMGDRCLFSLTISAEFAAGIDTLIYFWPKSKPEALFQLTQLLAQLPAGCDVFIVGENRAGVRSAEEMASGMLTLNKIDSARRCGLYHGLLAQPPHFDLNDWWMSYDTGSLRIATLPGVFSRDGLDIGSHLLLSSLPHGLKGRVLDVGCGAGVLSAAITRMSPETTLTLSDVNAAALTASRQTLAQNEIDGEILASNVFSDISGRFDLIISNPPFHDGVQTSLLAAQTLIRGAVSHLQLGGELRIVANAFLPYPQVLDAVFGRHEVVAQTGKFKVYSAILDRAALEQSRR

Download

Sequence (FASTA)