Domain assignment for gi|238918492|ref|YP_002932006.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 310 Ribokinase-like 6.39e-57 Ribokinase-like 0.0092 2fv7 A:15-322 Alignments
340 471 Nucleotidylyl transferase 2.73e-21 Cytidylyltransferase 0.0036 1coz A: Alignments

Protein Sequence Details

Sequence length 477
Comment RfaE bifunctional protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVETIEERPGGAANVAMNIASLGASARLVGLTGVDDAARALSTRLDEVHVECDFVAIPAQPTITKLRVLSRNQQLIRLDFEEGFGGVDPGPILARIRQALPQVGAVILSDYAKGALASVQAMICLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMERFDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLAASIAAGASLDEACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGEKVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTSRLKGPERPVNPLVQRMLVLAALEAVDWVIPFEEDTPQRIIAEILPDLLVKGGDYKPEEIAGGKEVIAAGGEVRVLNFEDGCSTSNIINIIRQGQND

Download

Sequence (FASTA)