Domain assignment for gi|238918471|ref|YP_002931985.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
33 131 Hypothetical protein YgiW 3.14e-34 Hypothetical protein YgiW 0.0000292 1nnx A: Alignments

Protein Sequence Details

Sequence length 133
Comment Protein unknown function (DUF388) [Edwardsiella ictaluri 93-146]
Sequence
MKKGAAIFAILALCSAPVLAQTGGFSGPGAMQQAQDTQQSGGFVSGQQAVTTVAKAKDLSDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTITPKDKVEIQGEIDKDWSTTKIDVKRLHKMN

Download

Sequence (FASTA)