Domain assignment for gi|238918469|ref|YP_002931983.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
296 453 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.56e-28 Histidine kinase 0.0047 1ysr A:299-446 Alignments
225 306 Homodimeric domain of signal transducing histidine kinase 0.0000000000000049 Homodimeric domain of signal transducing histidine kinase 0.003 2c2a A:232-320 Alignments

Protein Sequence Details

Sequence length 454
Comment sensory histidine kinase QseC, putative [Edwardsiella ictaluri 93-146]
Sequence
MRHLPRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNELFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLHKHRGDQDKDALAFAIFNADGRMLLNDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALSIVGGQMIPWLVALPVMVILLLLVVSRGLAPLHRLAAALGRRRPDDATPLPRDAIPSEVWPVVESLNTLFSRTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDIALRQRALGQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRVLAELLQTAVIDMDAKAHAAGVALALSVDDPKVRRRIQPLLFSLLIRNLLDNAICYSPAGSQVTLRLTSHRLQITDNGTGVSDAVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHEMQVQFSHAPGGGFQVTLRW

Download

Sequence (FASTA)