Domain assignment for gi|238918457|ref|YP_002931971.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 70
Comment hypothetical protein NT01EI_0501 [Edwardsiella ictaluri 93-146]
Sequence
MIGMVTIGVVLGYLTRNAIAAPAWKTPCVSQSNIIATYSACDTIMQPVAGYMLDPLGTQIDYAVFTVIWT

Download

Sequence (FASTA)