Domain assignment for gi|238918454|ref|YP_002931968.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 99 MFS general substrate transporter 0.00000000288 Glycerol-3-phosphate transporter 0.048 1pw4 A: Alignments

Protein Sequence Details

Sequence length 114
Comment hypothetical protein NT01EI_0498 [Edwardsiella ictaluri 93-146]
Sequence
MIGPGMIGLFSSPYIAIALLCIGGFAHQALSGSLITLSSNIFDRNEAATANGLTGMAAWTVSTLFALVSSTLTNTLDFSPRLATLGVFDLLDVLIIWTVLQNCTANDPLSLLPG

Download

Sequence (FASTA)