Domain assignment for gi|238918425|ref|YP_002931939.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 106 Ribosome-binding factor A, RbfA 3.66e-34 Ribosome-binding factor A, RbfA 0.0000049 1kkg A: Alignments

Protein Sequence Details

Sequence length 132
Comment ribosome-binding factor A, putative [Edwardsiella ictaluri 93-146]
Sequence
MAREFSRTQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRDLAYAKVFVTFLNDGEPETVKSGLKALQDASGFIRMLLGKAMRLRVVPELTFAYDASLVEGMRMSNLVSNVVKDDAARRSAADRDEEA

Download

Sequence (FASTA)