Domain assignment for gi|238918416|ref|YP_002931930.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 95 YhbY-like 1.44e-30 YhbY-like 0.0000125 1ln4 A: Alignments

Protein Sequence Details

Sequence length 97
Comment conserved hypothetical protein TIGR00253 [Edwardsiella ictaluri 93-146]
Sequence
MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHELIKVRIAAEERDTKTLIANAIVRETGAYNVQLIGNILVIYRPSEERKISLPR

Download

Sequence (FASTA)