Domain assignment for gi|238918412|ref|YP_002931926.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
186 353 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-30 Histidine kinase 0.0033 2c2a A:321-481 Alignments
120 194 Homodimeric domain of signal transducing histidine kinase 0.00000000000102 Homodimeric domain of signal transducing histidine kinase 0.0038 1joy A: Alignments

Protein Sequence Details

Sequence length 357
Comment two-component signal transduction histidine kinase, putative [Edwardsiella ictaluri 93-146]
Sequence
MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLSTKVRTEQVDKEIHAAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNLTPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELMEQSGVQEATMLVQRIDQLMHTVEQLLMLSRVGQNFASGHYPQLELINEVVLAQRSELCEMLALRGQHLRLETPSQIPMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSTDGHGSILQVIDRGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPGPGLNACCYLPLTPQDFG

Download

Sequence (FASTA)