Domain assignment for gi|238918392|ref|YP_002931906.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 242 Carbohydrate phosphatase 1.7e-68 Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.00097 2hhm A: Alignments

Protein Sequence Details

Sequence length 246
Comment 3'(2'),5'-bisphosphate nucleotidase, putative [Edwardsiella ictaluri 93-146]
Sequence
MLEQICQLARDAGATIMAVYQGDQPLALAYKGDESPVTAADLAAHEIIKAGLLRVTPLIPLLSEEEPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIALIEQGIPTLGVVYVPTSGVLYCACGGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAELTDYLQQLGEHQTMMVGSSLKFCLVAEGVAQLYPRFGPTHIWDTAAGHAIALAAGAQVRDWQGKTLSYIPAESLLNPGFRVSLY

Download

Sequence (FASTA)