Domain assignment for gi|238918328|ref|YP_002931842.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
86 200 S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000507 rRNA methyltransferase AviRa 0.048 1o9g A: Alignments

Protein Sequence Details

Sequence length 227
Comment hypothetical protein NT01EI_0365 [Edwardsiella ictaluri 93-146]
Sequence
MAGFIDHEKAFISLFNQTARYHHRHKVFEDFVSCSVIALENRLCFSEKREGKYLRIIGGYEKPDVIRMAQLLAHVVNGLQNGLCNFLGNVFMQLELGDKYRGQFFTPWDVARMMAQLQLGDVKAMFDEKPFITLHEPACGAGCMVLAFADALNQAGYASHLYLWVSATDIDPLAAGMAYIQLSLCGVAGEVVIGNALCDERRRVLLTPGHYLGSWSLRLHSRRKKVA

Download

Sequence (FASTA)