Domain assignment for gi|238918249|ref|YP_002931763.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
123 312 Glutathione synthetase ATP-binding domain-like 1.39e-58 ATP-binding domain of peptide synthetases 0.0000000535 1gsa A:123-314 Alignments
2 122 PreATP-grasp domain 4.6e-44 Prokaryotic glutathione synthetase, N-terminal domain 0.00000216 1gsa A:1-122 Alignments

Protein Sequence Details

Sequence length 316
Comment glutathione synthase, putative [Edwardsiella ictaluri 93-146]
Sequence
MIKLGIVMDPIASINIKKDTSFAMLLEAQHRDYQLHYMEMSDLYLQQGEARAQTRLLSVSDDKTSWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILERAEARGTLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDIILKPLDGMGGASIFRIQQDDPNLSVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVVDGEPVPYCLARIPKSGETRGNLAAGGRGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTEINVTSPTCAREIEAAFPVSITGMLMDAIEARLAAR

Download

Sequence (FASTA)