Domain assignment for gi|238918240|ref|YP_002931754.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
37 527 Periplasmic binding protein-like II 8e-145 Phosphate binding protein-like 0.000000000207 1jet A: Alignments

Protein Sequence Details

Sequence length 539
Comment periplasmic oligopeptide-binding protein superfamily [Edwardsiella ictaluri 93-146]
Sequence
MNIKYNLFLGYGLFMLIFGMGPSGGALAASVAPGVTLAAGQTLTRNNGSEPASLDPHKSESDVEFNIINDFFEGLVTMGPDGHIRPGLAERWENSEDGRIWRLYLRPGLQWSNGEPLTARDVVFSWQRQVDPATASPYGSYLANMHLENAIQIQAGQQPPEALGIRAVDDVTLQITLTRPLSTFLSMLVHPSLMTVNPRVIARFGDKWTQPGNFVSSGAYTLQRWVVNERLEGVRNPRYWDNAHTVINQVTYLPIVSETADVNRYKAGEIDITASVPSPQFAALRRELGEQVHIAPKLATYYYYFNTRKPPFDDPRVRLALNLGLDKDVIADKVLGQGQRPAWLFSAGKIGGMTLLPPEYAAWPREQRLARARALLTEAGFGPDSPLHFTLLYNTSEGHQRIAIAASSMWKKNLGVEAALNNQEWKTMLDTMRSGNFDLVRSGWVADYDDPSAFLNTFRSADSNNTPQYVNPRYDALLAGAADSQDPEKRQQLFQQAETILAAEVPAIPLYHYVSVRLVKPHVGGFRAANKTVQQSASR

Download

Sequence (FASTA)