Domain assignment for gi|238918236|ref|YP_002931750.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
16 236 S-adenosyl-L-methionine-dependent methyltransferases 1.53e-41 TrmB-like 0.0012 1yzh A:8-211 Alignments

Protein Sequence Details

Sequence length 238
Comment tRNA (guanine-N(7)-)-methyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MNDVITAEFDENGRAIRRIRSFVRRQGRLTKGQQLALDEYWPLMGVEFTPEALDLPTLFGREAPVVLEIGFGMGASLVAMAQQHPERDFLGIEVHSPGVGACLSSAHEAGVNNLRVMCHDAVEVLERMIPDASLDMVQLFFPDPWHKARHHKRRIVQSAFAGRIRGKLKISGVFHMATDWENYAEHMLEVMNHAPGYRNLSDDNTYVPRPDSRPVTKFELRGQRLGHGNWDLMFERVE

Download

Sequence (FASTA)