Domain assignment for gi|238918232|ref|YP_002931746.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
53 132 ACT-like 5.95e-27 Nickel responsive regulator NikR, C-terminal domain 0.00013 1q5y A: Alignments
1 41 Ribbon-helix-helix 0.000000000256 CopG-like 0.0046 1q5v A:1-48 Alignments

Protein Sequence Details

Sequence length 145
Comment nickel-responsive transcriptional regulator NikR, putative [Edwardsiella ictaluri 93-146]
Sequence
MQRVTLSLDDDLMAEIDAIIRAGNYQNRSEVIRDLARAGLQSMAQAPSPSACCVAALFYVYDHESRELSKRLTRTFHDHHDLSLASLHVHLDHGSCLEVSLLKGAGGEVTRFAERVIAERGVRHGKLVVVPGDEGVAPPHPHSHD

Download

Sequence (FASTA)