Domain assignment for gi|238918214|ref|YP_002931728.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
74 232 Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000000123 Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0033 2ch7 B:225-529 Alignments

Protein Sequence Details

Sequence length 284
Comment hypothetical protein NT01EI_0250 [Edwardsiella ictaluri 93-146]
Sequence
MIHLFNSMNIYPGIPIPDIPAENSSPEPDAVAAVLDSRHNYERILCHGPLSGVKSIEAGGNTTLLKFIERLMQERQFIDTLNEKNNQSYNSMYALEQIISEIGVNSEEEIKISSALKQAVSDINHSIADVNRLSNQTNLPAMETAHVSAQGCGFSFIVKVIKSRASEVKQHAAQIALLSNTISARAGQVCESVSAIHALITRISQEMASTSETLEQVIERSGHMQKIIHHIAIQQFLNMVKRVHIIWKYQVCHYLFIRDRQAVMNVHHSCRLGHRYYTGEGVMI

Download

Sequence (FASTA)