Domain assignment for gi|238918211|ref|YP_002931725.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
190 241 Homeodomain-like 0.0000000000709 Tetracyclin repressor-like, N-terminal domain 0.081 2g7g A:9-73 Alignments
243 293 Homeodomain-like 0.00000000134 AraC type transcriptional activator 0.045 1bl0 A:63-124 Alignments

Protein Sequence Details

Sequence length 303
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MVIDDRWKQLAAQVQRLHQQPGVKPSPVGHVNLIYVNAHQPRTPVMYQPSLIIILQGRKVGYLGERVFHYDPSNYLLMTLPLPCECETFASPQEPLIGLALRVDVQMLQDLLMDIGDGMRTAVRPHADGVRSVALDDAMLCACERLVEAMEDSLHARVLGPQIVREMLFHALCGAGGDALLALASRHSHFSQIAKALRLIEQNYASSLNVDRLAQSVNMSISSFHHNFKAVTATSPLQYIKSYRLHKARMMILHDGLKASTAASRVGYESPSQFSREYKRFFGNTPSDQASRYRSGGLRIAEL

Download

Sequence (FASTA)