Domain assignment for gi|238918188|ref|YP_002931702.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
32 501 MFS general substrate transporter 3.66e-45 LacY-like proton/sugar symporter 0.056 1pv7 A: Alignments

Protein Sequence Details

Sequence length 558
Comment transporter, major facilitator family [Edwardsiella ictaluri 93-146]
Sequence
MSVDNSVPTPRGDERRAADVRPGFFSKARIIARPGFNRWLVPPAALAIHLCIGMAYGFSVFWLPLSQALGGGAAQACPAQMSAWQELFTTRCDWRISMLGWTYTLFFIFLGCSAALWGSWLEKAGPRKVGVVAACCWCGGLMFSALGVYLHQLWMLWLGSGVIGGIGLGLGYISPVSTLIRWFPDRRGMATGLAIMGFGGGAMVGAPLANSLMHFYTAAGGVGVWQTFLTLALIYWVFMLAGALAYRIPPIGWRPQGMAAATETPAAQGFTHVEVHVSVACRTPQFWLLWAVLCLNVSAGIGIIGMASPLLQEVFAGRLLGGTQSFAELSSAQLAQIAAIAAGFTGLLSLFNIGGRFFWASLSDRIGRNRTFFLFFALGMVLYGLLPTLGALGSVTLFALAFCLIVSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGILGPVLVNYLREYQLSRGIARAQAYSETLYILAGLLLVGLVCNLLIRPVDRRHTMSEAQLAQARSLYKVDPNAQLSWSADAGSRLWVALSWLAVGLPLLWGCWITLLQAGQLFG

Download

Sequence (FASTA)