Domain assignment for gi|238918183|ref|YP_002931697.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 243 P-loop containing nucleoside triphosphate hydrolases 6.96e-86 ABC transporter ATPase domain-like 0.00000000914 1q12 A:4-235 Alignments
236 363 MOP-like 3.64e-33 ABC-transporter additional domain 0.00000283 1q12 A:236-370 Alignments

Protein Sequence Details

Sequence length 369
Comment ABC transporter, ATP-binding protein [Edwardsiella ictaluri 93-146]
Sequence
MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTLLRMIAGLEDITSGELQIAGVRMNEVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAGVSKAEIQQRVNQVAETLQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSNLDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLALYHYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVQVELPNGQHIWLPVAGEGLRPGSNLSLGIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGATLAIGLPAERCHLFREDGSACQRLYQEPGV

Download

Sequence (FASTA)