Domain assignment for gi|238918156|ref|YP_002931670.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 103
Comment Protein of unknown function, DUF485 [Edwardsiella ictaluri 93-146]
Sequence
MNDTIYQEIEENPRFKELVRKRGRFVWLLSLITLALYVGFILLIAFDPQWLGTPIAAGSTITRGIPVGVGLIVISFILTGIYVFRANGEFDRLTAEILSEVKQ

Download

Sequence (FASTA)