Domain assignment for gi|238918152|ref|YP_002931666.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
104 319 Glutathione synthetase ATP-binding domain-like 5.48e-66 BC ATP-binding domain-like 0.000000015 1gso A:104-327 Alignments
1 103 PreATP-grasp domain 2.59e-36 BC N-terminal domain-like 0.00000926 1gso A:-2-103 Alignments
329 423 Rudiment single hybrid motif 3.98e-29 BC C-terminal domain-like 0.0000331 1gso A:328-426 Alignments

Protein Sequence Details

Sequence length 425
Comment phosphoribosylamine-glycine ligase, putative [Edwardsiella ictaluri 93-146]
Sequence
MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTAQEPALENINIPATDIDALVAFALHHQVGLTIVGPEAPLVLGVVDAFRAAGLTIFGPSQSAARLEGSKAFSKDFLVRQRIPTAAYRNFTEIEPALAYVREQGVPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDAGHRIVVEAFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVSDAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGEPKVIEFNCRFGDPETQPIMMRMQSDLVALCLAGANGTLDRQSSVWDPRPALGVVLAAGGYPGDYRQGDLIHGLTPGCAQAKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRNAYRLADGLSWEGGFCRRDIGYRALQR

Download

Sequence (FASTA)