Domain assignment for gi|238918116|ref|YP_002931630.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
22 249 S-adenosyl-L-methionine-dependent methyltransferases 2.63e-50 UbiE/COQ5-like 0.023 1xxl A: Alignments

Protein Sequence Details

Sequence length 251
Comment ubiquinone/menaquinone biosynthesis methyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MVDQTPETTHFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSFGIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAARFSRMVGEQGEVILADINDSMLKIGREKLRNMGIVGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSRPQFVALSKAYDAYSFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLKGMMAAAGFENTTYDNLTGGIVALHRGYKF

Download

Sequence (FASTA)