Domain assignment for gi|238918086|ref|YP_002931600.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
11 225 Periplasmic binding protein-like II 8.28e-85 Phosphate binding protein-like 0.0000000311 1pda A:3-219 Alignments
226 314 Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 6.28e-28 Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0000292 1gtk A:220-313 Alignments

Protein Sequence Details

Sequence length 317
Comment porphobilinogen deaminase, putative [Edwardsiella ictaluri 93-146]
Sequence
MQSMTTATQPTLRIATRQSPLALWQAHYVRDQLLAQWPQLTIELVPMVTRGDVLLDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTICQREDPRDAFVSPRFASLEQLPPGSVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLAKLDAGDYDAIILAAAGLKRLQLEDRIRTPLTPEQSLPAVGQGAVGIECRLADDATRRLLAPLNHAETALRVCAERAMNTRLEGGCQVPIGSYAEIDGDRLWLRALVGAPDGSLMICGERRGPLAQAEAMGTALADELLARGARAILDAVYCQKA

Download

Sequence (FASTA)