Domain assignment for gi|238918080|ref|YP_002931594.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 358
Comment TDP-Fuc4NAc:lipid II Fuc4Nac transferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MTTLIHVLGADIPHHNLTLLRFFDGVLSQRAATAPRRRFMVVARDAAPFAALTTLDIEVWPDKRALARALLARARADRTLRFFLHGQFNPWLWLALLCGRLRPQQVLWHVWGADLYEEARGWKYRLYYGLRRLAQGRVGHVFATQGDLDYYRQRHPRVATSTLYFPTRMDPALTCNQRVRETSGALTVLVGNSGDRSNRHLVALQRLHDTFGPQTRVIVPLGYPANNQAYIAQVRERAESLFGHNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTLCLLLQQGIPPVLSRQNPFWRDMAAQQLPVLFDDDAPDDVAVRAAQRQLALRDLSQIAFFDPNYIDGWLQALALGERP

Download

Sequence (FASTA)