Domain assignment for gi|238918059|ref|YP_002931573.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 79 ACT-like 0.000000000269 IlvH-like 0.02 2fgc A:27-104 Alignments

Protein Sequence Details

Sequence length 96
Comment acetolactate synthase isozyme II, small subunit, putative [Edwardsiella ictaluri 93-146]
Sequence
MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDGDCDSVNIELTVASTRPVTLLSSQLIKLLDVARVDVSAPRSLRMLPRRQVLG

Download

Sequence (FASTA)