Domain assignment for gi|238918054|ref|YP_002931568.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 396 PLP-dependent transferases 1.73e-121 GABA-aminotransferase-like 0.0000000000177 1fc4 A: Alignments

Protein Sequence Details

Sequence length 398
Comment 2-amino-3-ketobutyrate coenzyme A ligase, putative [Edwardsiella ictaluri 93-146]
Sequence
MSADFYQQLAQQLVATRAEGLYKTERIITSAQQAEIAVADGSRVLNFCANNYLGLADHPALIAAAKEGMESHGFGMASVRFICGTQDSHKALEQQLAAFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKARRYRYANNDMAELKARLELARAEGARHIMIATDGVFSMDGVIADLRSICDLADEYDALVMVDDSHAVGFVGGHGRGTPEYCGVVGRVDIMTGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASSRVLTLLAQGDDLRARLWDNARLFREKMTAAGFTLAGADHAIIPVMLGEAKLAQHFADLLLQEGIYVTGFFYPVVPQGQARIRTQMSAAHTPAQIEQAVAAFIRVGKQLGVIA

Download

Sequence (FASTA)