Domain assignment for gi|238918048|ref|YP_002931562.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 102 UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000195 Glycosyl transferases group 1 0.039 2f9f A:2-167 Alignments

Protein Sequence Details

Sequence length 129
Comment hypothetical protein NT01EI_0067 [Edwardsiella ictaluri 93-146]
Sequence
MLTTLAAGTYGIPTITSNINGLPETVRHQQIGFCLTPTLSVEQYANISAASIDFSPQVYDPVQDRLTPPLILSPEQLADSIESLYRNPETYRRLSDGAREYAAVSRCFNDLAQTLCQRLLTRADPRPHG

Download

Sequence (FASTA)