Domain assignment for gi|238918042|ref|YP_002931556.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
56 418 UDP-Glycosyltransferase/glycogen phosphorylase 1.67e-19 Glycosyl transferases group 1 0.087 2f9f A:2-167 Alignments

Protein Sequence Details

Sequence length 424
Comment 3-deoxy-D-manno-octulosonic-acid transferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MESLYTVLLYIIQPLIWLRLLLRSRRAPAYRKRWGERYGFCRNKVAPGGILLHSVSVGETLAAVPLVRALRHRYPTLPITVTTMTPTGSERVMSAFGNDVHHVYLPYDLPGAMRRFLNTVRPKLVIVMETELWPNMISALHQRKIPLVIANARLSARSAKGYGKLGGFMRRLLRKVTLIAAQNQEDGERFIALGLKRSQLAITGSIKFDISVTPELAARAITLRRQWAPRRKVWIAASTHQGEEAIILQTHRRLLAQFPDLLLILVPRHPERFKETELLAQKEGFTYLMRSSGEIPTPHTQVVIGDSMGELMLLYGIADLAFVGGSLIERGGHNPLEPAAHAIPVLMGPHTFNFKDICAKLHQADGLISVADGEALANEVSTLLTDEDYRLWYGRHAVEVLHQNQGALQRLLQLLLPYLPLRSH

Download

Sequence (FASTA)