Domain assignment for gi|238918039|ref|YP_002931553.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 138 N-terminal domain of MutM-like DNA repair proteins 1.57e-42 N-terminal domain of MutM-like DNA repair proteins 0.00000248 1k82 A:1-128 Alignments
130 222 S13-like H2TH domain 5.89e-30 Middle domain of MutM-like DNA repair proteins 0.0000719 1k82 A:129-216 Alignments
217 268 Glucocorticoid receptor-like (DNA-binding domain) 9.41e-18 C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0013 1k82 A:225-268 Alignments

Protein Sequence Details

Sequence length 269
Comment formamidopyrimidine-DNA glycosylase, putative [Edwardsiella ictaluri 93-146]
Sequence
MPELPEVETSRRGIAPFLQGKTLSHLTVRQPRLRWPVSETLLTLRDRPILSVQRRAKYLLLELPEGWIVIHLGMSGSVRILPALTPPQKHDHIDLLLTDGMMLRYTDPRRFGAWLWYDSLATASVLAHLGPEPLSEAFSAEYLLEKARGRRTAVKPWLMDNTLVVGVGNIYASESLFSAQIHPDRLAGSLSADEAHLLVQTIKAVLQRSIDQGGTTLRDFLQADGKPGYFAQQLQVYGRAGEACLTCGTTIKRSKHGQRTTFYCPHCQR

Download

Sequence (FASTA)