Domain assignment for gi|508606054|ref|YP_006991793.2| from Carnobacterium maltaromaticum LMA28

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
69 154 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 5.89e-29 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.00015 1sfe A:93-176 Alignments
2 74 Methylated DNA-protein cysteine methyltransferase domain 0.00000000000114 Methylated DNA-protein cysteine methyltransferase domain 0.013 1qnt A:6-91 Alignments

Protein Sequence Details

Sequence length 161
Comment methylated-DNA--protein-cysteine methyltransferase, constitutive [Carnobacterium maltaromaticum LMA28]
Sequence
MLINSPIGFLHILEDQQGITNIIFVNEEEALAIKKVTTGPFGKQLALELERYFSGELKKFTVPLSLQVGTPFQQHVWQALQNVPYGSTQSYADIAVAIENPKAVRAIGQANRNNPLPIVIPCHRIIGKNGSMTGYSGASEIGIAKKRYLLALEKNNCVSAR

Download

Sequence (FASTA)