Domain assignment for gi|508605546|ref|YP_006991136.2| from Carnobacterium maltaromaticum LMA28

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
90 171 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 8.63e-29 Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.00015 1sfe A:93-176 Alignments
9 88 Methylated DNA-protein cysteine methyltransferase domain 0.00000000000135 Methylated DNA-protein cysteine methyltransferase domain 0.012 1sfe A:12-92 Alignments

Protein Sequence Details

Sequence length 173
Comment methylated-DNA--protein-cysteine methyltransferase, inducible [Carnobacterium maltaromaticum LMA28]
Sequence
MSNMSEIKHIYWSQLNFLEWQMIVAKTEKGLCFIGSNQGTAKELEKWMRKRYSDFKLIQDDDKLAASIEALTNYLKGKQRDFKIELDIIGTDFQKDVWESLKAIPYGETRNYSMIADSIKRPKAVRAVGTAIGANPLLIIVPCHRVLGKNKRLTGYRGGLAMKERLIALESAK

Download

Sequence (FASTA)