Domain assignment for gi|94992332|ref|YP_600431.1| from Streptococcus pyogenes MGAS2096

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
51 249 YojJ-like 1.44e-65 YojJ-like 0.0000354 2fb5 A:5-205 Alignments

Protein Sequence Details

Sequence length 283
Comment hypothetical protein MGAS2096_Spy0835 [Streptococcus pyogenes MGAS2096]
Sequence
MNNLSSIDIKFLLSLFADPWLLAVHLLDILIVAYLIYRFIKALTGTKIMSLVQGVIFFLVLRFIAEWIGFTTITYLMNQVITYGVIAGVVIFTPEIRAGLEKFGRSTQVFLQKQYVSSESALVDALIKSVAYMGPRKIGALIAIEQTQTLQEYIATGIPLNADISSQLLINIFIPNTPLHDGAVIVGQNKIVAACAYLPLSESKAISKEFGTRHRAAIGLSENSDALTIIVSEETGAISVTRKGQFLHDLSTDEFETVLRTYLMSDSNVSLPWYKKILGGKSK

Download

Sequence (FASTA)