Domain assignment for Thhalv10002046m|PACid:20200513 from Thellungiella halophila v173

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
61 314 HD-domain/PDEase-like 2.67e-115 MioX-like 0.000000335 2huo A:28-285 Alignments

Protein Sequence Details

Sequence length 314
Comment
Sequence
MTILVEHYVTDSIIEEKKKRGDELVLDGGFVVPKSKEADGFDAPDINFLGHSFRDYENGASERQQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNVVDDSDPDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVVGDTFPVGCTFDSANIHHKYFKENPDTNNTKYSTKNGVYSEGCGLDNVLMSWGHDDYMYLVAKENGSTLPHAGLFIIRYHSFYPLHKAGTYTHLMNDEDKEDLKWLHVFNKYDLYSKSKVHVDVEQVKPYYISLINKYFPEKLRW

Download

Sequence (FASTA)