Domain assignment for gi|387627332|ref|YP_006063508.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 112 Ribosome binding protein Y (YfiA homologue) 2.88e-29 Ribosome binding protein Y (YfiA homologue) 0.00062 2ywq A:1-95 Alignments

Protein Sequence Details

Sequence length 182
Comment sigma-54 modulation protein / S30EA ribosomal protein [Streptococcus pneumoniae INV104]
Sequence
MIKYSIRGENLEVTEAIRDYVVSKLEKIEKYFQPEQELDARINLKVYREKTAKVEVTIPLGSITLRAEDVSQDMYGSIDLVTDKIERQIRKNKTKIERKNKNKVATGQLFTDALVEDSNVVQSKVVRSKQIDLKPMDLEEAILQMDLLGHDFFIYVDVEDQTTNVIYRREDGEIGLLEVKES

Download

Sequence (FASTA)